PDB entry 1ymz

View 1ymz on RCSB PDB site
Description: CC45, An Artificial WW Domain Designed Using Statistical Coupling Analysis
Class: unknown function
Keywords: artificial protein, computational design, unknown function
Deposited on 2005-01-22, released 2005-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cc45
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YMZ (Start-42)
    Domains in SCOPe 2.08: d1ymza1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ymzA (A:)
    gshgrsmplppgwerrtdvegkvyyfnvrtltttwerptiile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ymzA (A:)
    mplppgwerrtdvegkvyyfnvrtltttwerptiile