PDB entry 1ymv

View 1ymv on RCSB PDB site
Description: signal transduction protein chey mutant with phe 14 replaced by gly, ser 15 replaced by gly, and met 17 replaced by gly
Class: chemotaxis
Keywords: chemotaxis, sensory transduction, phosphorylation
Deposited on 1995-12-14, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chey
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (Start-128)
      • engineered (13-14)
      • engineered (16)
    Domains in SCOPe 2.07: d1ymva_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ymvA (A:)
    rsdkelkflvvddggtgrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
    pnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
    nkifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ymvA (A:)
    lkflvvddggtgrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpnmdg
    lellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnkife
    klgm