PDB entry 1ymt

View 1ymt on RCSB PDB site
Description: Mouse SF-1 LBD
Deposited on 2005-01-21, released 2005-03-15
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.197
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Steroidogenic factor 1
    Species: Mus musculus [TaxId:10090]
    Gene: Nr5a1, Ftzf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33242 (0-End)
      • cloning artifact (0-1)
      • engineered (87)
      • engineered (191)
      • engineered (196)
      • engineered (206)
  • Chain 'B':
    Compound: Nuclear receptor 0B2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DR9, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ymtA (A:)
    gssggpnvpelilqllqlepeedqvrarivgclqepaksrsdqpapfsllcrmadqtfis
    ivdwarrcmvfkelevadqmtllqnswsellvldhiyrqvqygkedsillvtgqevelst
    vavqagsllhslvlraqelvlqlhalqldrqefvclkflilfsldvkflnnhslvkdaqe
    kanaalldytlshyphsgdkfqqlllslvevralsmqakeylyhkhlgnemprnnlliem
    lqakqt
    

    Sequence, based on observed residues (ATOM records):
    >1ymtA (A:)
    gssggpnvpelilqllqlepeedqvrarivgclqqpapfsllcrmadqtfisivdwarrc
    mvfkelevadqmtllqnswsellvldhiyrqvqygkedsillvtgqevelstvavqagsl
    lhslvlraqelvlqlhalqldrqefvclkflilfsldvkflnnhslvkdaqekanaalld
    ytlshyphsgdkfqqlllslvevralsmqakeylyhkhlgnemprnnlliemlqa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ymtB (B:)
    rptilyallspspr
    

    Sequence, based on observed residues (ATOM records):
    >1ymtB (B:)
    rptilyalls