PDB entry 1ymp

View 1ymp on RCSB PDB site
Description: The Crystal Structure of a Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve an Ankyrin Fold
Class: transcription
Keywords: ankyrin repeats, helix-turn-helix, TRANSCRIPTION
Deposited on 2005-01-21, released 2005-05-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Notch 1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: Notch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ympa_
  • Chain 'B':
    Compound: Notch 1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: Notch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ympb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ympA (A:)
    lrnratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnn
    vdaavvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdi
    aqermhhdivrllde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ympA (A:)
    ratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnnvda
    avvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdiaqe
    rmhhdivrlld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ympB (B:)
    lrnratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnn
    vdaavvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdi
    aqermhhdivrllde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ympB (B:)
    ratdldarmhdgttplilaarlalegmledlinshadvnavddlgksalhwaaavnnvda
    avvllkngankdmqnnkeetplflaaregsyetakvlldhfanrditdhmdrlprdiaqe
    rmhhdivrlld