PDB entry 1ymi

View 1ymi on RCSB PDB site
Description: Crystal structure of a mutant of human protein kinase CK2alpha with altered cosubstrate specificity
Class: transferase
Keywords: protein kinase CK2, casein kinase 2, casein kinase II, TRANSFERASE
Deposited on 2005-01-21, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-01-22, with a file datestamp of 2008-01-18.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.186
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase II, alpha chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68400 (0-333)
      • engineered (64)
      • engineered (161)
    Domains in SCOPe 2.07: d1ymia_
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ymiA (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvavkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvlidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqarmg