PDB entry 1ymg

View 1ymg on RCSB PDB site
Description: The Channel Architecture of Aquaporin O at 2.2 Angstrom Resolution
Class: membrane protein
Keywords: AQP0, Integral Membrane Protein, MIP26, Lens, Cataract, Water Channel, MEMBRANE PROTEIN
Deposited on 2005-01-20, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.24
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lens fiber major intrinsic protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ymga1
  • Heterogens: BNG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ymgA (A:)
    mwelrsasfwraicaeffaslfyvffglgaslrwapgplhvlqvalafglalatlvqavg
    hisgahvnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalnt
    lhpgvsvgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytg
    agmnparsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkgs
    rpsesngqpevtgepvelktqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ymgA (A:)
    sasfwraicaeffaslfyvffglgaslrwagplhvlqvalafglalatlvqavghisgah
    vnpavtfaflvgsqmsllraicymvaqllgavagaavlysvtppavrgnlalntlhpgvs
    vgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmnpa
    rsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg