PDB entry 1ymf

View 1ymf on RCSB PDB site
Description: crystal structure of yellow fever virus ns3 helicase complexed with adp
Deposited on 2005-01-20, released 2005-08-23
Made obsolete by 5ffm on 2015-12-30

The last revision was dated 2015-12-30, with a file datestamp of 2015-12-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein [contains: Flavivirin protease NS3 catalytic subunit]
    Species: Yellow fever virus [TaxId:11089]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19901 (3-439)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (8)
      • modified residue (52)
      • modified residue (81)
      • modified residue (90)
      • modified residue (104)
      • modified residue (135)
      • modified residue (192)
      • modified residue (234)
      • modified residue (313)
      • modified residue (318)
      • modified residue (324)
      • modified residue (343)
  • Heterogens: ADP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ymfA (A:)
    gshmlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgl
    dvkfhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaarg
    waahraranesatilmtatppgtsdefphsngeiedvqtdipsepwntghdwiladkrpt
    awflpsiraanvmaaslrkagksvvvlnrktfereyptikqkkpdfilatdiaemganlc
    vervldcrtafkpvlvdegrkvaikgplrisassaaqrrgrigrnpnrdgdsyyysepts
    ennahhvcwleasmlldnmevrggmvaplygvegtktpvspgemrlrddqrkvfrelvrn
    cdlpvwlswqvakaglktndrkwcfegpeeheilndsgetvkcrapggakkplrprwcde
    rvssdqsalsefikfaegrr
    

    Sequence, based on observed residues (ATOM records):
    >1ymfA (A:)
    shmlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgld
    vkfhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaargw
    aahraranesatilmtatppgtsdefphsngeiedvqtdipsepwntghdwiladkrpta
    wflpsiraanvmaaslrkagksvvvlnrktfekkpdfilatdiaemganlcvervldcrt
    afkpvlvdegrkvaikgplrisassaaqrrgrigrnpnrdgdsyyyseptsennahhvcw
    leasmlldnmevrggmvaplygvegtktpvspgemrlrddqrkvfrelvrncdlpvwlsw
    qvakaglktndrkwcfegpeeheilndsgetvkcrapggakkplrprwcdervssdqsal
    sefikfaegrr