PDB entry 1yme

View 1yme on RCSB PDB site
Description: structure of carboxypeptidase
Class: carboxypeptidase
Keywords: carboxypeptidase, metalloproteinase, metalloexoproteinase
Deposited on 1996-07-15, released 1997-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.148
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a alpha
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ymea_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ymeA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ymeA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn