PDB entry 1ymd

View 1ymd on RCSB PDB site
Description: Crystal Structure of the CDC25B phosphatase catalytic domain with the active site cysteine in the sulfonic form
Class: hydrolase, cell cycle
Keywords: Sulfinic Cysteine, HYDROLASE, CELL CYCLE
Deposited on 2005-01-20, released 2005-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M-phase inducer phosphatase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC25B, CDC25HU2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30305 (1-174)
      • initiating methionine (0)
      • modified residue (97)
    Domains in SCOPe 2.08: d1ymda2, d1ymda3
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ymdA (A:)
meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdravn
dypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw

    Sequence, based on observed residues (ATOM records): (download) 
    >1ymdA (A:)
meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapkrvilifhcefssergprmcrfirerdravndyps
lyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw