PDB entry 1ymc

View 1ymc on RCSB PDB site
Description: three-dimensional structure of cyanomet-sulfmyoglobin c
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1993-09-27, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2 Å
R-factor: 0.129
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanomet-sulfmyoglobin
    Species: Equus caballus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ymca_
  • Heterogens: SO4, CYN, CLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ymcA (A:)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg