PDB entry 1ym9

View 1ym9 on RCSB PDB site
Description: Crystal structure of the CDC25B phosphatase catalytic domain with the active site cysteine in the sulfinic form
Class: hydrolase, cell cycle
Keywords: Sulfinic Cysteine, HYDROLASE, CELL CYCLE
Deposited on 2005-01-20, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M-phase inducer phosphatase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC25B, CDC25HU2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30305 (1-174)
      • initiating methionine (0)
      • modified residue (97)
    Domains in SCOPe 2.07: d1ym9a_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ym9A (A:)
    meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
    hiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdravn
    dypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ym9A (A:)
    meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
    hiktavnlplerdaesfllkspiapkrvilifhcefssergprmcrfirerdravndyps
    lyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw