PDB entry 1ym5

View 1ym5 on RCSB PDB site
Description: Crystal structure of YHI9, the yeast member of the phenazine biosynthesis PhzF enzyme superfamily.
Deposited on 2005-01-20, released 2005-08-02
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 32.6 kDa protein in DAP2-SLT2 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38765 (Start-293)
      • expression tag (294)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ym5A (A:)
    mtlmvpfkqvdvftekpfmgnpvavinfleidenevsqeelqaianwtnlsettflfkps
    dkkydyklriftprselpfaghptigsckafleftknttatslvqeckigavpitinegl
    isfkapmadyesissemiadyekaiglkfikppallhtgpewivalvedaetcfnanpnf
    amlahqtkqndhvgiilagpkkeaaiknsyemrafapvinvyedpvcgsgsvalarylqe
    vykfekttditiseggrlkrnglmlasikkeadnstsyyiaghattvidgkikvhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ym5A (A:)
    tlmvpfkqvdvftekpfmgnpvavinfleidenevsqeelqaianwtnlsettflfkpsd
    kkydyklriftprselpfaghptigsckafleftknttatslvqeckigavpitinegli
    sfkapmadyesissemiadyekaiglkfikppallhtgpewivalvedaetcfnanpnfa
    mlahqtkqndhvgiilagpkkeaaiknsyemrafapvinvyedpvcgsgsvalarylqev
    ykfekttditiseggrlkrnglmlasikkeadnstsyyiaghattvidgkikvh