PDB entry 1ym3

View 1ym3 on RCSB PDB site
Description: crystal structure of carbonic anhydrase rv3588c from mycobacterium tuberculosis
Deposited on 2005-01-20, released 2005-03-08
The last revision was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.181
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase (carbonate dehydratase) (carbonic dehydratase)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv3588c
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ym3A (A:)
    mahhhhhhgpntnpvaawkalkegnerfvagrpqhpsqsvdhraglaagqkptavifgca
    dsrvaaeiifdqglgdmfvvrtaghvidsavlgsieyavtvlnvplivvlghdscgavna
    alaaindgtlpggyvrdvvervapsvllgrrdglsrvdefeqrhvhetvailmarssais
    eriaggslaivgvtyqlddgravlrdhignigeev
    

    Sequence, based on observed residues (ATOM records):
    >1ym3A (A:)
    tnpvaawkalkegnerfvagrpqhpsqsqkptavifgcadsrvaaeiifdqglgdmfvvr
    taghvidsavlgsieyavtvlnvplivvlghdscgavnaalaaindgtlpggyvrdvver
    vapsvllgrrdglsrvdefeqrhvhetvailmarssaiseriaggslaivgvtyqlddgr
    avlrdhignigee