PDB entry 1ym0

View 1ym0 on RCSB PDB site
Description: Crystal Structure of Earthworm Fibrinolytic Enzyme Component B: a Novel, Glycosylated Two-chained Trypsin
Class: hydrolase
Keywords: two chains, glycosylation, pyroglutamation, eight-membered ring, cis peptide bond, hydrolase
Deposited on 2005-01-20, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrinotic enzyme component B
    Species: Eisenia fetida [TaxId:6396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ym0a_
  • Chain 'B':
    Compound: fibrinotic enzyme component B
    Species: Eisenia fetida [TaxId:6396]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YM0 (10-22)
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ym0A (A:)
    ivggiearpyefpwqvsvrrkssdshfcggsiindrwvvcaahcmqgeapalvslvvgeh
    dssaastvrqthdvdsifvnenydpatlendvsviktavaitfdinvgpicapdpandyv
    yrksqcsgwgtinsggvccpavlryvtlnittnafcdavytsdtiyddmicatdntgmtd
    rdscqgdsggplsvkdgsgifslvgivswgigcasgypgvysrvgfhagwitdtitnn
    

  • Chain 'B':
    No sequence available.