PDB entry 1ylx

View 1ylx on RCSB PDB site
Description: Crystal Structure of a Protein of Unknown Function from Bacillus stearothermophilus
Class: structural genomics, unknown function
Keywords: hypothetical protein, Bacillus stearothermophilus, dimer, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-01-19, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.229
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein APC35702
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YLX (Start-102)
    Domains in SCOPe 2.07: d1ylxa1
  • Chain 'B':
    Compound: hypothetical protein APC35702
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YLX (Start-102)
    Domains in SCOPe 2.07: d1ylxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ylxA (A:)
    snamefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitih
    mpfvknergelalekqewtvrkdgrekkgfhslqeameevihs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylxA (A:)
    mefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitihmpf
    vknergelalekqewtvrkdgrekkgfhslqeameevihs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ylxB (B:)
    snamefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitih
    mpfvknergelalekqewtvrkdgrekkgfhslqeameevihs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylxB (B:)
    mefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitihmpf
    vknergelalekqewtvrkdgrekkgfhslqeameevihs