PDB entry 1ylv

View 1ylv on RCSB PDB site
Description: schiff-base complex of yeast 5-aminolaevulinic acid dehydratase with laevulinic acid
Class: lyase
Keywords: dehydratase, aldolase, tim barrel, tetrapyrrole synthesis
Deposited on 1999-02-22, released 2000-02-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (5-aminolaevulinic acid dehydratase)
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ylva_
  • Heterogens: ZN, SHF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ylvA (A:)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
    ekfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
    grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
    ekgvvdlktiafeshtgflragarliitylapefldwldeen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylvA (A:)
    mhtaefletepteissvlaggynhpllrqwqserqltknmlifplfisdnpddfteidsl
    pninrigvnrlkdylkplvakglrsvilfgvplipgtkdpvgtaaddpagpviqgikfir
    ekfpelyiicdvclceytshghcgvlyddgtinrersvsrlaavavnyakagahcvapsd
    midgrirdikrglinanlahktfvlsyaakfsgnlygpfrdaacsapsngdrkcyqlppa
    grglarralerdmsegadgiivkpstfyldimrdaseickdlpicayhvsgeyamlhaaa
    ekgvvdlktiafeshtgflragarliitylapefldwldee