PDB entry 1ylu

View 1ylu on RCSB PDB site
Description: The structure of E. coli nitroreductase with bound acetate, crystal form 2
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Oxygen-insensitive NAD(P)H nitroreductase
Deposited on 2005-01-19, released 2005-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.147
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Escherichia coli [TaxId:562]
    Gene: nfnB, dprA, nfsB, nfsI, ntr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ylua_
  • Chain 'B':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Escherichia coli [TaxId:562]
    Gene: nfnB, dprA, nfsB, nfsI, ntr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ylub_
  • Heterogens: ACT, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yluA (A:)
    mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
    aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
    rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
    kgytslvvvpvghhsvedfnatlpksrlpqnitltev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yluA (A:)
    diisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarva
    ksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkgr
    kffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglkek
    gytslvvvpvghhsvedfnatlpksrlpqnitltev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yluB (B:)
    mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
    aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
    rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
    kgytslvvvpvghhsvedfnatlpksrlpqnitltev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yluB (B:)
    diisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarva
    ksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkgr
    kffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglkek
    gytslvvvpvghhsvedfnatlpksrlpqnitltev