PDB entry 1ylq

View 1ylq on RCSB PDB site
Description: Crystal structure of putative nucleotidyltransferase
Class: transferase
Keywords: nucleotidyltransferase, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2005-01-19, released 2005-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.217
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative nucleotidyltransferase, hypothetical protein AF0614
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29641 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1ylqa1, d1ylqa2
  • Chain 'B':
    Compound: putative nucleotidyltransferase, hypothetical protein AF0614
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29641 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1ylqb2, d1ylqb3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ylqA (A:)
    aghmkeikeitkkdvqdaeiylygsvvegdysiglsdidvaivsdvfedrnrkleffgki
    tkkffdspfefhiltkkewkmskrfirkyrrldlit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylqA (A:)
    aghmkeikeitkkdvqdaeiylygsvvegdysiglsdidvaivsdvfedrnrkleffgki
    tkkffdspfefhiltkkewkmskrfirkyrrld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ylqB (B:)
    aghmkeikeitkkdvqdaeiylygsvvegdysiglsdidvaivsdvfedrnrkleffgki
    tkkffdspfefhiltkkewkmskrfirkyrrldlit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylqB (B:)
    aghmkeikeitkkdvqdaeiylygsvvegdysiglsdidvaivsdvfedrnrkleffgki
    tkkffdspfefhiltkkewkmskrfirkyrrld