PDB entry 1yln

View 1yln on RCSB PDB site
Description: The Crystal Structure of the Protein of Unknown Function VCA0042 from Vibrio cholerae O1
Class: structural genomics, unknown function
Keywords: Vibrio cholerae O1, beta barrels, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-01-19, released 2005-03-08
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein vca0042
    Species: Vibrio cholerae O1
    Gene: GI:9657424
    Database cross-references and differences (RAF-indexed):
    • GB AAF95956
      • modified residue (38)
    Domains in SCOP 1.73: d1ylna1, d1ylna2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ylnA (A:)
    mnsrpaekidnndgqtetprsktvstinstdalamvehsseltlsittpvgtkfvcrtpf
    igthtdkfllvempkisaddlqyffqegfwmniraisprgegalihfrsqlmhilqepvp
    maflsipntmqvsqlrkeprfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyq
    vgdlvaleifsdlrgtktfppltgkicnlqrslhharyglefneegrnnaknllaqlkfn
    gtkltlnaekka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylnA (A:)
    tvstinstdalamvehsseltlsittpvgtkfvcrtpfigthtdkfllvempkisaddlq
    yffqegfwmniraisprgegalihfrsqlmhilqepvpmaflsipntmqvsqlrkeprfe
    lnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtktfppl
    tgkicnlqrslhharyglefneegrnnaknllaqlkfngtkltlna