PDB entry 1ylm

View 1ylm on RCSB PDB site
Description: Structure of Cytosolic Protein of Unknown Function YutE from Bacillus subtilis
Deposited on 2005-01-19, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.202
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BSU32300
    Species: Bacillus subtilis [TaxId:224308]
    Gene: YutE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32126 (0-End)
      • modified residue (0)
      • modified residue (55)
      • modified residue (61)
      • modified residue (71)
  • Chain 'B':
    Compound: hypothetical protein BSU32300
    Species: Bacillus subtilis [TaxId:224308]
    Gene: YutE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32126 (0-End)
      • modified residue (0)
      • modified residue (55)
      • modified residue (61)
      • modified residue (71)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ylmA (A:)
    myfvdrskiektlgffehqlalfdsqtdwqseigelalqrighlliecildtgndmidgf
    imrdpgsyddimdilvdekvvtekegdelkkliayrktlvqqylladsgelyrlikahqt
    alqdfpkrirsyletelgpvsafk
    

    Sequence, based on observed residues (ATOM records):
    >1ylmA (A:)
    myfvdrskiektlgffehqlalfdsqtdwqseigelalqrighlliecildtgndmidgf
    imrdpgsyddimdilvdekvvtekegdelkkliayrktlvqqylladsgelyrlikahqt
    alqdfpkrirsyletelgpvsaf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ylmB (B:)
    myfvdrskiektlgffehqlalfdsqtdwqseigelalqrighlliecildtgndmidgf
    imrdpgsyddimdilvdekvvtekegdelkkliayrktlvqqylladsgelyrlikahqt
    alqdfpkrirsyletelgpvsafk
    

    Sequence, based on observed residues (ATOM records):
    >1ylmB (B:)
    myfvdrskiektlgffehqlalfdsqtdwqseigelalqrighlliecildtgndmidgf
    imrdpgsyddimdilvdekvvtekegdelkkliayrktlvqqylladsgelyrlikahqt
    alqdfpkrirsyletelgpvsaf