PDB entry 1ylk

View 1ylk on RCSB PDB site
Description: Crystal Structure of Rv1284 from Mycobacterium tuberculosis in Complex with Thiocyanate
Class: unknown function
Keywords: Rv1284, homodimer, alpha/beta-fold, Structural Proteomics in Europe, SPINE, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2005-01-19, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Rv1284/MT1322
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1284
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64797 (10-171)
      • cloning artifact (9)
    Domains in SCOPe 2.07: d1ylka1, d1ylka2
  • Chain 'B':
    Compound: Hypothetical protein Rv1284/MT1322
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1284
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64797 (10-171)
      • cloning artifact (9)
    Domains in SCOPe 2.07: d1ylkb1, d1ylkb2
  • Chain 'C':
    Compound: Hypothetical protein Rv1284/MT1322
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1284
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64797 (10-171)
      • cloning artifact (9)
    Domains in SCOPe 2.07: d1ylkc1, d1ylkc2
  • Chain 'D':
    Compound: Hypothetical protein Rv1284/MT1322
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1284
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64797 (10-171)
      • cloning artifact (9)
    Domains in SCOPe 2.07: d1ylkd1, d1ylkd2
  • Heterogens: ZN, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ylkA (A:)
    mahhhhhhsgtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikeg
    eahvirnagcvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgi
    rptwspesypdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylkA (A:)
    gtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnag
    cvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesy
    pdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ylkB (B:)
    mahhhhhhsgtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikeg
    eahvirnagcvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgi
    rptwspesypdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylkB (B:)
    gtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnag
    cvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesy
    pdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ylkC (C:)
    mahhhhhhsgtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikeg
    eahvirnagcvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgi
    rptwspesypdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylkC (C:)
    gtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnag
    cvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesy
    pdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ylkD (D:)
    mahhhhhhsgtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikeg
    eahvirnagcvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgi
    rptwspesypdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylkD (D:)
    gtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnag
    cvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesy
    pdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp