PDB entry 1ylj

View 1ylj on RCSB PDB site
Description: Atomic resolution structure of CTX-M-9 beta-lactamase
Class: hydrolase
Keywords: CTX-M, beta-lactamase, anisotropy, extended-spectrum, HYDROLASE
Deposited on 2005-01-19, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: N/A
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase CTX-M-9a
    Species: Escherichia coli [TaxId:562]
    Gene: CTX-M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ylja_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yljA (A:)
    qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl