PDB entry 1yli

View 1yli on RCSB PDB site
Description: Crystal structure of HI0827, a hexameric broad specificity acyl-coenzyme A thioesterase
Class: hydrolase
Keywords: Structural Genomics, HI0827, YCIA_HAEIN, thioesterase, coenzyme A, Structure 2 Function Project, S2F, HYDROLASE
Deposited on 2005-01-19, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative acyl-CoA thioester hydrolase HI0827
    Species: Haemophilus influenzae [TaxId:727]
    Gene: YCIA-HAEIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ylia_
  • Chain 'B':
    Compound: Putative acyl-CoA thioester hydrolase HI0827
    Species: Haemophilus influenzae [TaxId:727]
    Gene: YCIA-HAEIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ylib_
  • Heterogens: CA, COA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yliA (A:)
    sanftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvt
    vavesmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavft
    fvavdnngrsrtiprennqelekalaliseqpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yliA (A:)
    rqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvavesmnfi
    kpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnngr
    srtiprennqelekalaliseq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yliB (B:)
    sanftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvt
    vavesmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavft
    fvavdnngrsrtiprennqelekalaliseqpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yliB (B:)
    ftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvav
    esmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfva
    vdnngrsrtiprennqelekalaliseq