PDB entry 1ylf

View 1ylf on RCSB PDB site
Description: X-ray crystal structure of BC1842 protein from Bacillus cereus, a member of the Rrf2 family of putative transcription regulators.
Class: transcription regulator
Keywords: structural genomics, RRF2 family, transcription regulator, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-01-19, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RRF2 family protein
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: BC1842
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81EX1
      • modified residue (35)
      • modified residue (50)
      • modified residue (126)
      • modified residue (135)
    Domains in SCOPe 2.07: d1ylfa1
  • Chain 'B':
    Compound: RRF2 family protein
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: BC1842
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81EX1
      • modified residue (35)
      • modified residue (50)
      • modified residue (126)
      • modified residue (135)
    Domains in SCOPe 2.07: d1ylfb_
  • Chain 'C':
    Compound: RRF2 family protein
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: BC1842
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81EX1
      • modified residue (35)
      • modified residue (50)
      • modified residue (126)
      • modified residue (135)
    Domains in SCOPe 2.07: d1ylfc_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ylfA (A:)
    snamitmkissrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfv
    yvnrgpggagllkdlheitlldvyhavnvveedklfhiheqpnpdcpiganiqavleiil
    iqaqsameevlrnitmgqlfetlqekmna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylfA (A:)
    kissrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnggag
    llkdlheitlldvyhavnviganiqavleiiliqaqsameevlrnitmgqlfetlqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ylfB (B:)
    snamitmkissrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfv
    yvnrgpggagllkdlheitlldvyhavnvveedklfhiheqpnpdcpiganiqavleiil
    iqaqsameevlrnitmgqlfetlqekmna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylfB (B:)
    ssrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgga
    gllkdlheitlldvyhavnvcpiganiqavleiiliqaqsameevlrnitmgqlfetl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ylfC (C:)
    snamitmkissrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfv
    yvnrgpggagllkdlheitlldvyhavnvveedklfhiheqpnpdcpiganiqavleiil
    iqaqsameevlrnitmgqlfetlqekmna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylfC (C:)
    issrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgg
    agllkdlheitlldvyhavnvganiqavleiiliqaqsameevlrnitmgqlfetlqek