PDB entry 1yle

View 1yle on RCSB PDB site
Description: The structure of arginine/ornithine succinyltransferase subunit AI from Pseudomonas aeruginosa.
Class: transferase
Keywords: Pseudomonas aeruginosa, structural genomics, Arginine N-succinyltransferase, acyltransferase; Arginine metabolism, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2005-01-19, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine N-succinyltransferase, alpha chain
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: astA, aruF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80357 (2-339)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (5)
      • modified residue (150)
      • modified residue (227)
      • modified residue (242)
      • cloning artifact (340-341)
    Domains in SCOPe 2.07: d1ylea1, d1ylea2, d1ylea3
  • Heterogens: CA, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yleA (A:)
    ghmlvmrpaqaadlpqvqrlaadspvgvtslpddaerlrdkilaseasfaaevsyngees
    yffvledsasgelvgcsaivasagfsepfysfrnetfvhasrslsihnkihvlslchdlt
    gnslltsfyvqrdlvqsvyaelnsrgrllfmashperfadavvveivgysdeqgespfwn
    avgrnffdlnyieaeklsglksrtflaelmphypiyvpllpdaaqesmgqvhpraqitfd
    ilmregfetdnyidifdggptlhartsgirsiaqsrvvpvkigeapksgrpylvtngqlq
    dfravvldldwapgkpvalsveaaealgvgegasvrlvavgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yleA (A:)
    ghmlvmrpaqaadlpqvqrlaadspvgvtslpddaerlrdkilaseasfaaevsyngees
    yffvledsasgelvgcsaivasagfsepfysfrnetfvhasrslsihnkihvlslchdlt
    gnslltsfyvqrdlvqsvyaelnsrgrllfmashperfadavvveivgysdeqgespfwn
    avgrnffdlnyieaeklsglkhypiyvpllpdaaqesmgqvhpraqitfdilmregfetd
    nyidifdggptlhartsgirsiaqsrvvpvkigeksgrpylvtngqlqdfravvldldwa
    pgkpvalsveaaealgvgegasvrlvavgs