PDB entry 1yld

View 1yld on RCSB PDB site
Description: Trypsin/BPTI complex mutant
Class: hydrolase/inhibitor
Keywords: BPTI, trypsin, complex, HYDROLASE/INHIBITOR COMPLEX
Deposited on 2005-01-19, released 2006-04-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2008-05-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin II
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Try2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-215)
      • engineered (176)
    Domains in SCOPe 2.04: d1ylda_
  • Chain 'B':
    Compound: pancreatic trypsin inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-55)
      • engineered (4)
      • engineered (25-26)
      • engineered (29)
      • engineered (50)
      • engineered (54)
    Domains in SCOPe 2.04: d1yldb1
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yldA (A:)
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yldB (B:)
rpdfaleppytgpckariiryfynapdglaqtfvyggcrakrnnfksaedamrtag