PDB entry 1yla

View 1yla on RCSB PDB site
Description: Ubiquitin-conjugating enzyme E2-25 kDa (Huntington interacting protein 2)
Class: ligase
Keywords: UBIQUITIN, UBIQUITIN- CONJUGATING ENZYME, LIGASE, Structural Genomics, SGC, Structural Genomics Consortium
Deposited on 2005-01-19, released 2005-02-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2-25 kDa
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP2, LIG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61086 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d1ylaa1, d1ylaa2
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2-25 kDa
    Species: Homo sapiens [TaxId:9606]
    Gene: HIP2, LIG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61086 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d1ylab1, d1ylab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ylaA (A:)
    gsmaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryql
    eikipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqalla
    aaepddpqdavvanqykqnpemfkqtarlwahvyagapvsspeytkkienlcamgfdrna
    vivalsskswdvetatelllsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylaA (A:)
    gsmaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryql
    eikipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqalla
    aaepddpqdavvanqykqnpemfkqtarlwahvyagapvsspeytkkienlcamgfdrna
    vivalsskswdvetatellls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ylaB (B:)
    gsmaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryql
    eikipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqalla
    aaepddpqdavvanqykqnpemfkqtarlwahvyagapvsspeytkkienlcamgfdrna
    vivalsskswdvetatelllsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ylaB (B:)
    gsmaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryql
    eikipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqalla
    aaepddpqdavvanqykqnpemfkqtarlwahvyagapvsspeytkkienlcamgfdrna
    vivalsskswdvetatellls