PDB entry 1yl7

View 1yl7 on RCSB PDB site
Description: the crystal structure of Mycobacterium tuberculosis dihydrodipicolinate reductase (Rv2773c) in complex with NADH (crystal form C)
Class: oxidoreductase
Keywords: lysine biosynthesis, dihydrodipicolinate, reductase, NADH, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, OXIDOREDUCTASE
Deposited on 2005-01-19, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (1-244)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yl7a1, d1yl7a2, d1yl7a3
  • Chain 'B':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (1-244)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yl7b1, d1yl7b2, d1yl7b3
  • Chain 'C':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (1-244)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yl7c1, d1yl7c2, d1yl7c3
  • Chain 'D':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (1-244)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yl7d1, d1yl7d2, d1yl7d3
  • Chain 'E':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (1-244)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yl7e1, d1yl7e2, d1yl7e3
  • Chain 'F':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (1-244)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yl7f1, d1yl7f2, d1yl7f3
  • Chain 'G':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (1-244)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yl7g1, d1yl7g2, d1yl7g3
  • Chain 'H':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (1-244)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yl7h1, d1yl7h2, d1yl7h3
  • Heterogens: MG, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl7A (A:)
    arvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl7B (B:)
    arvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl7C (C:)
    arvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl7D (D:)
    arvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl7E (E:)
    arvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl7F (F:)
    arvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl7G (G:)
    arvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl7H (H:)
    arvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh