PDB entry 1yl6

View 1yl6 on RCSB PDB site
Description: crystal structure of Mycobacterium tuberculosis dihydrodipicolinate reductase (Rv2773c) (crystal form B)
Class: oxidoreductase
Keywords: lysine biosynthesis, dihydrodipicolinate, reductase, NADH, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, OXIDOREDUCTASE
Deposited on 2005-01-19, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (1-244)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yl6a1, d1yl6a2, d1yl6a3
  • Chain 'B':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (1-244)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1yl6b1, d1yl6b2, d1yl6b3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl6A (A:)
    arvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl6B (B:)
    arvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh