PDB entry 1yl5

View 1yl5 on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis dihydrodipicolinate reductase (RV2773C) (crystal form A)
Class: oxidoreductase
Keywords: lysine biosynthesis, dihydrodipicolinate, reductase, NADH, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, OXIDOREDUCTASE
Deposited on 2005-01-19, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (3-246)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1yl5a1, d1yl5a2, d1yl5a3
  • Chain 'B':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72024 (3-246)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1yl5b1, d1yl5b2, d1yl5b3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl5A (A:)
    amarvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvv
    mgnleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakq
    aarffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvd
    gipvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvgl
    eplldlh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yl5B (B:)
    amarvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvv
    mgnleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakq
    aarffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvd
    gipvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvgl
    eplldlh