PDB entry 1yku

View 1yku on RCSB PDB site
Description: Crystal structure of a sensor domain homolog
Deposited on 2005-01-18, released 2006-04-25
The last revision was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.178
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein pXO2-61
    Species: Bacillus anthracis [TaxId:1392]
    Gene: pXO2-61
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hypothetical protein pXO2-61
    Species: Bacillus anthracis [TaxId:1392]
    Gene: pXO2-61
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ykuA (A:)
    meeikcllcrylkerqekfisdwkkkviirerdpykeeiikngehllsafimylkeeisl
    qeieitskkiareridakvniaefihntnvakieimniltllnpdlqqyqalvkkinqff
    dhliyytvhsyyeqka
    

    Sequence, based on observed residues (ATOM records):
    >1ykuA (A:)
    kcllcrylkerqekfisdwkkkviirerdpykeeiikngehllsafimylkeeislqeie
    itskkiareridakvniaefihntnvakieimniltllnpdlqqyqalvkkinqffdhli
    yytvhsyyeqka
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ykuB (B:)
    meeikcllcrylkerqekfisdwkkkviirerdpykeeiikngehllsafimylkeeisl
    qeieitskkiareridakvniaefihntnvakieimniltllnpdlqqyqalvkkinqff
    dhliyytvhsyyeqka
    

    Sequence, based on observed residues (ATOM records):
    >1ykuB (B:)
    kcllcrylkerqekfisdwkkkviirerdpykeeiikngehllsafimylkeeislqeie
    itskkiareridakvniaefihntnvakieimniltllnpdlqqyqalvkkinqffdhli
    yytvhsyyeqka