PDB entry 1ykt

View 1ykt on RCSB PDB site
Description: Trypsin/Bpti complex mutant
Class: hydrolase
Keywords: BPTI, Trypsin, mutant, HYDROLASE
Deposited on 2005-01-18, released 2006-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-05-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin II
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Try2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (176)
    Domains in SCOPe 2.07: d1ykta_
  • Chain 'B':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yktb_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yktA (A:)
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yktB (B:)
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg