PDB entry 1ykt

View 1ykt on RCSB PDB site
Description: Trypsin/Bpti complex mutant
Class: hydrolase
Keywords: BPTI, Trypsin, mutant
Deposited on 2005-01-18, released 2006-04-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin II
    Species: Rattus norvegicus
    Gene: Try2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (176)
    Domains in SCOP 1.73: d1ykta1
  • Chain 'B':
    Compound: pancreatic trypsin inhibitor
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yktb1
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yktA (A:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yktB (B:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg