PDB entry 1yks

View 1yks on RCSB PDB site
Description: Crystal structure of yellow fever virus NS3 helicase
Class: hydrolase
Keywords: helicase, flavivirus, DEAD-box, ATPase, RTPase, Yellow fever virus, HYDROLASE
Deposited on 2005-01-18, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein [contains: Flavivirin protease NS3 catalytic subunit]
    Species: Yellow fever virus [TaxId:11089]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19901 (3-439)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1yksa1, d1yksa2, d1yksa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yksA (A:)
    gshmlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgl
    dvkfhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaarg
    waahraranesatilmtatppgtsdefphsngeiedvqtdipsepwntghdwiladkrpt
    awflpsiraanvmaaslrkagksvvvlnrktfereyptikqkkpdfilatdiaemganlc
    vervldcrtafkpvlvdegrkvaikgplrisassaaqrrgrigrnpnrdgdsyyysepts
    ennahhvcwleasmlldnmevrggmvaplygvegtktpvspgemrlrddqrkvfrelvrn
    cdlpvwlswqvakaglktndrkwcfegpeeheilndsgetvkcrapggakkplrprwcde
    rvssdqsalsefikfaegrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yksA (A:)
    shmlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgld
    vkfhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaargw
    aahraranesatilmtatppgtsdefphsngeiedvqtdipsepwntghdwiladkrpta
    wflpsiraanvmaaslrkagksvvvlnrktfekkpdfilatdiaemganlcvervldcrt
    afkpvlvdegrkvaikgplrisassaaqrrgrigrnpnrdgdsyyyseptsennahhvcw
    leasmlldnmevrggmvaplygvegtktpvspgemrlrddqrkvfrelvrncdlpvwlsw
    qvakaglktndrkwcfegpeeheilndsgetvkcrapggakkplrprwcdervssdqsal
    sefikfaegrr