PDB entry 1ykm

View 1ykm on RCSB PDB site
Description: Protocatechuate 3,4-Dioxygenase Y408E mutant
Class: oxidoreductase
Keywords: catechol, protocatechuate, OXIDOREDUCTASE
Deposited on 2005-01-18, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.169
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykma_
  • Chain 'B':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykmb1
  • Chain 'C':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykmc_
  • Chain 'D':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykmd_
  • Chain 'E':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykme_
  • Chain 'F':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykmf_
  • Chain 'G':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykmg_
  • Chain 'H':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykmh_
  • Chain 'I':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykmi_
  • Chain 'J':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykmj_
  • Chain 'K':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykmk_
  • Chain 'L':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykml_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmA (A:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmB (B:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrerhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmC (C:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmD (D:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrerhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmE (E:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmF (F:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrerhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmG (G:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmH (H:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrerhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmI (I:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmJ (J:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrerhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmK (K:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykmL (L:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrerhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc