PDB entry 1ykk

View 1ykk on RCSB PDB site
Description: Protocatechuate 3,4-Dioxygenase Y408C Mutant
Class: oxidoreductase
Keywords: 3,4-PCD, catechol, protocatechuate, dioxygenase, OXIDOREDUCTASE
Deposited on 2005-01-18, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykka_
  • Chain 'B':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykkb1
  • Chain 'C':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykkc_
  • Chain 'D':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykkd_
  • Chain 'E':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykke_
  • Chain 'F':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykkf_
  • Chain 'G':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykkg_
  • Chain 'H':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykkh_
  • Chain 'I':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykki_
  • Chain 'J':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykkj_
  • Chain 'K':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: pcaG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykkk_
  • Chain 'L':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Pseudomonas putida [TaxId:303]
    Gene: PCAH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00437 (0-237)
      • engineered (107)
      • modified residue (128)
    Domains in SCOPe 2.07: d1ykkl_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkA (A:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkB (B:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkC (C:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkD (D:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkE (E:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkF (F:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkG (G:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkH (H:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkI (I:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkJ (J:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkK (K:)
    piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
    hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
    pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
    tayrfdiriqgegetvffdf
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykkL (L:)
    paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
    hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld
    pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
    egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc