PDB entry 1yki

View 1yki on RCSB PDB site
Description: The structure of E. coli nitroreductase bound with the antibiotic nitrofurazone
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Oxygen-insensitive NAD(P)H nitroreductase
Deposited on 2005-01-18, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.145
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Escherichia coli [TaxId:562]
    Gene: nfnB, dprA, nfsB, nfsI, ntr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykia_
  • Chain 'B':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Escherichia coli [TaxId:562]
    Gene: nfnB, dprA, nfsB, nfsI, ntr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykib_
  • Chain 'C':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Escherichia coli [TaxId:562]
    Gene: nfnB, dprA, nfsB, nfsI, ntr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykic_
  • Chain 'D':
    Compound: oxygen-insensitive nad(p)h nitroreductase
    Species: Escherichia coli [TaxId:562]
    Gene: nfnB, dprA, nfsB, nfsI, ntr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykid_
  • Heterogens: FMN, NFZ, CIT, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ykiA (A:)
    mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
    aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
    rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
    kgytslvvvpvghhsvedfnatlpksrlpqnitltev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykiA (A:)
    diisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarva
    ksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkgr
    kffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglkek
    gytslvvvpvghhsvedfnatlpksrlpqnitltev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykiB (B:)
    mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
    aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
    rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
    kgytslvvvpvghhsvedfnatlpksrlpqnitltev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ykiC (C:)
    mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
    aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
    rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
    kgytslvvvpvghhsvedfnatlpksrlpqnitltev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykiC (C:)
    diisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarva
    ksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkgr
    kffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglkek
    gytslvvvpvghhsvedfnatlpksrlpqnitltev
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykiD (D:)
    mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
    aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
    rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
    kgytslvvvpvghhsvedfnatlpksrlpqnitltev