PDB entry 1ykh

View 1ykh on RCSB PDB site
Description: Structure of the mediator MED7/MED21 (Med7/Srb7) subcomplex
Class: gene regulation
Keywords: gene regulation
Deposited on 2005-01-18, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.257
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II mediator complex protein MED7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykha_
  • Chain 'B':
    Compound: RNA polymerase II holoenzyme component SRB7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47822
      • engineered (4)
      • engineered (118)
      • engineered (124)
    Domains in SCOPe 2.07: d1ykhb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ykhA (A:)
    masmkkstenestnyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvn
    ihhllneyrphqsreslimlleeqleykrgeireieqvckqvhdklts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykhA (A:)
    nyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvnihhllneyrphqs
    reslimlleeqleykrgeireieqvckqvhdklts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ykhB (B:)
    mtdrmtqlqicldqmteqfcatlnyidknhgferltvnepqmsdkhatvvppeefsntid
    elstdiilktrqinklidslpgvdvsaeeqlrkidmlqkklvevedekieaikkkeklmr
    hvdsmiedfvdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykhB (B:)
    tdrmtqlqicldqmteqfcatlnyidknhgfevvppeefsntidelstdiilktrqinkl
    idslpgvdvsaeeqlrkidmlqkklvevedekieaikkkeklmrhvdsmiedfv