PDB entry 1ykg

View 1ykg on RCSB PDB site
Description: Solution structure of the flavodoxin-like domain from the Escherichia coli sulfite reductase
Class: electron transport
Keywords: flavoprotein, electron transport
Deposited on 2005-01-18, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfite reductase [nadph] flavoprotein alpha-component
    Species: Escherichia coli [TaxId:562]
    Gene: cysJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykga1
  • Heterogens: FMN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ykgA (A:)
    atpapaaempgitiisasqtgnarrvaealrddllaaklnvklvnagdykfkqiasekll
    ivvtstqgegeppeeavalhkflfskkapklentafavfslgdtsyeffcqsgkdfdskl
    aelggerlldrvdadveyqaaasewrarvvdalksrapvaapsqsva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykgA (A:)
    itiisasqtgnarrvaealrddllaaklnvklvnagdykfkqiasekllivvtstqgege
    ppeeavalhkflfskkapklentafavfslgdtsyeffcqsgkdfdsklaelggerlldr
    vdadveyqaaasewrarvvdalksra