PDB entry 1ykf

View 1ykf on RCSB PDB site
Description: nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
Deposited on 1996-03-25, released 1998-01-14
The last revision prior to the SCOP 1.59 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykfA (A:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykfB (B:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykfC (C:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykfD (D:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila