PDB entry 1ykf

View 1ykf on RCSB PDB site
Description: nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1996-03-25, released 1998-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Thermoanaerobacter brockii [TaxId:29323]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ykfa1, d1ykfa2
  • Chain 'B':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Thermoanaerobacter brockii [TaxId:29323]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ykfb1, d1ykfb2
  • Chain 'C':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Thermoanaerobacter brockii [TaxId:29323]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ykfc1, d1ykfc2
  • Chain 'D':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Thermoanaerobacter brockii [TaxId:29323]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ykfd1, d1ykfd2
  • Heterogens: ZN, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykfA (A:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykfB (B:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykfC (C:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykfD (D:)
    mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
    avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
    geffhvndadmnlahlpkeipleaavmipdmmttgfhgaeladielgatvavlgigpvgl
    mavagaklrgagriiavgsrpvcvdaakyygatdivnykdgpiesqimnltegkgvdaai
    iaggnadimatavkivkpggtianvnyfgegevlpvprlewgcgmahktikgglcpggrl
    rmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila