PDB entry 1yke

View 1yke on RCSB PDB site
Description: Structure of the mediator MED7/MED21 subcomplex
Class: gene regulation
Keywords: gene regulation
Deposited on 2005-01-18, released 2005-02-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.279
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II mediator complex protein MED7
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ykea1
  • Chain 'B':
    Compound: RNA polymerase II holoenzyme component SRB7
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ykeb1
  • Chain 'C':
    Compound: RNA polymerase II mediator complex protein MED7
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ykec1
  • Chain 'D':
    Compound: RNA polymerase II holoenzyme component SRB7
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yked1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ykeA (A:)
    masmkkstenestnyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvn
    ihhllneyrphqsreslimlleeqleykrgeireieqvckqvhdklts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykeA (A:)
    estnyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvnihhllneyrp
    hqsreslimlleeqleykrgeireieqvckqvhdklts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ykeB (B:)
    mtdrltqlqicldqmteqfcatlnyidknhgferltvnepqmsdkhatvvppeefsntid
    elstdiilktrqinklidslpgvdvsaeeqlrkidmlqkklvevedekieaikkkekllr
    hvdsliedfvdgianskkstaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykeB (B:)
    drltqlqicldqmteqfcatlnyidknhgferltvvppeefsntidelstdiilktrqin
    klidslpgvdvsaeeqlrkidmlqkklvevedekieaikkkekllrhvdsliedfvdgi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ykeC (C:)
    masmkkstenestnyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvn
    ihhllneyrphqsreslimlleeqleykrgeireieqvckqvhdklts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykeC (C:)
    estnyqykiqelrkllkslllnyleligvlsinpdmyerkvenirtilvnihhllneyrp
    hqsreslimlleeqleykrgeireieqvckqvhdklts
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ykeD (D:)
    mtdrltqlqicldqmteqfcatlnyidknhgferltvnepqmsdkhatvvppeefsntid
    elstdiilktrqinklidslpgvdvsaeeqlrkidmlqkklvevedekieaikkkekllr
    hvdsliedfvdgianskkstaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykeD (D:)
    drltqlqicldqmteqfcatlnyidknhgfevvppeefsntidelstdiilktrqinkli
    dslpgvdvsaeeqlrkidmlqkklvevedekieaikkkekllrhvdsliedfv