PDB entry 1ykd

View 1ykd on RCSB PDB site
Description: Crystal Structure of the Tandem GAF Domains from a Cyanobacterial Adenylyl Cyclase: Novel Modes of Ligand-Binding and Dimerization
Deposited on 2005-01-17, released 2005-02-22
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate cyclase
    Species: Anabaena sp. [TaxId:1167]
    Gene: cyaB2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: adenylate cyclase
    Species: Anabaena sp. [TaxId:1167]
    Gene: cyaB2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CMP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ykdA (A:)
    vteveqklqivhqtlsmldshgfenilqemlqsitlktgellgadrttiflldeekqelw
    sivaagegdrsleiripadkgiagevatfkqvvnipfdfyhdprsifaqkqekitgyrty
    tmlalpllseqgrlvavvqllnklkpysppdallaeridnqgftsadeqlfqefapsirl
    ilessrsfyiatqkqraaaammkavkslsqssldledtlkrvmdeakelmnadrstlwli
    drdrhelwtkitqdngstkelrvpigkgfagivaasgqklnipfdlydhpdsatakqidq
    qngyrtcsllcmpvfngdqeligvtqlvnkkktgefppynpetwpiapecfqasfdrnde
    efmeafniqagvalqnaqlfatvkqqeqgsrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ykdA (A:)
    vteveqklqivhqtlsmldshgfenilqemlqsitlktgellgadrttiflldeekqelw
    sivaagegdrsleiripadkgiagevatfkqvvnipfdfyhdprsifaqkqekitgyrty
    tmlalpllseqgrlvavvqllnklkpysppdallaeridnqgftsadeqlfqefapsirl
    ilessrsfyiatqkqraaaammkavkslsqssldledtlkrvmdeakelmnadrstlwli
    drdrhelwtkitqdngstkelrvpigkgfagivaasgqklnipfdlydhpdsatakqidq
    qngyrtcsllcmpvfngdqeligvtqlvnkkktgefppynpetwpiapecfqasfdrnde
    efmeafniqagvalqnaqlfatv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ykdB (B:)
    vteveqklqivhqtlsmldshgfenilqemlqsitlktgellgadrttiflldeekqelw
    sivaagegdrsleiripadkgiagevatfkqvvnipfdfyhdprsifaqkqekitgyrty
    tmlalpllseqgrlvavvqllnklkpysppdallaeridnqgftsadeqlfqefapsirl
    ilessrsfyiatqkqraaaammkavkslsqssldledtlkrvmdeakelmnadrstlwli
    drdrhelwtkitqdngstkelrvpigkgfagivaasgqklnipfdlydhpdsatakqidq
    qngyrtcsllcmpvfngdqeligvtqlvnkkktgefppynpetwpiapecfqasfdrnde
    efmeafniqagvalqnaqlfatvkqqeqgsrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ykdB (B:)
    vteveqklqivhqtlsmldshgfenilqemlqsitlktgellgadrttiflldeekqelw
    sivaagsleiripadkgiagevatfkqvvnipfdfyhdprsifaqkqekitgyrtytmla
    lpllseqgrlvavvqllnklkpysppdallaeridnqgftsadeqlfqefapsirliles
    srsfyiatqkqraaaammkavkslsqssldledtlkrvmdeakelmnadrstlwlidrdr
    helwtkitqdngstkelrvpigkgfagivaasgqklnipfdlydhpdsatakqidqqngy
    rtcsllcmpvfngdqeligvtqlvnkkktgefppynpetwpiapecfqasfdrndeefme
    afniqagvalqnaqlfatvk