PDB entry 1ykc

View 1ykc on RCSB PDB site
Description: human glutathione S-transferase m2-2 (E.C.2.5.1.18) complexed with glutathione-disulfide
Class: transferase
Keywords: transferase, glutathione, conjugation,glutathione-disulfide, prostaglandin E2, synthase
Deposited on 2005-01-17, released 2005-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase Mu 2
    Species: HOMO SAPIENS
    Gene: GSTM2, GST4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ykca1, d1ykca2
  • Chain 'B':
    Compound: Glutathione S-transferase Mu 2
    Species: HOMO SAPIENS
    Gene: GSTM2, GST4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ykcb1, d1ykcb2
  • Heterogens: GDS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykcA (A:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykcB (B:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk