PDB entry 1ykb

View 1ykb on RCSB PDB site
Description: Crystal Structure of Insect Cell Expressed IL-22
Class: cytokine
Keywords: interleukin, cytokine, il-22, glycosylation
Deposited on 2005-01-17, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.232
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (Interleukin-22)
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22, ILTIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykba_
  • Chain 'B':
    Compound: PROTEIN (Interleukin-22)
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22, ILTIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykbb_
  • Chain 'C':
    Compound: PROTEIN (Interleukin-22)
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22, ILTIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykbc_
  • Chain 'D':
    Compound: PROTEIN (Interleukin-22)
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22, ILTIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykbd_
  • Chain 'E':
    Compound: PROTEIN (Interleukin-22)
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22, ILTIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykbe_
  • Chain 'F':
    Compound: PROTEIN (Interleukin-22)
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22, ILTIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ykbf_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ykbA (A:)
    shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
    ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
    sgeikaigeldllfmslrnaci
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ykbA (A:)
    hcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnf
    tleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklges
    geikaigeldllfmslrnaci
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykbB (B:)
    shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
    ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
    sgeikaigeldllfmslrnaci
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykbC (C:)
    shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
    ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
    sgeikaigeldllfmslrnaci
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykbD (D:)
    shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
    ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
    sgeikaigeldllfmslrnaci
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykbE (E:)
    shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
    ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
    sgeikaigeldllfmslrnaci
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ykbF (F:)
    shcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvln
    ftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklge
    sgeikaigeldllfmslrnaci