PDB entry 1yka

View 1yka on RCSB PDB site
Description: Solution structure of Grx4, a monothiol glutaredoxin from E. coli.
Class: Electron Transport
Keywords: Mixed alpha/beta fold, Thioredoxin fold, Electron Transport
Deposited on 2005-01-17, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: monothiol glutaredoxin ydhD
  Species: Escherichia coli [TaxId:562]
  Gene: ydhd
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AC69 (0-114)
  Domains in SCOPe 2.07: d1ykaa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ykaA (A:)
  msttiekiqrqiaenpillymkgspklpscgfsaqavqalaacgerfayvdilqnpdira
  elpkyanwptfpqlwvdgelvggcdiviemyqrgelqqliketaakykseepdae