PDB entry 1yk9

View 1yk9 on RCSB PDB site
Description: Crystal structure of a mutant form of the mycobacterial adenylyl cyclase Rv1625c
Class: lyase
Keywords: beta-alpha-beta sandwich, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, LYASE
Deposited on 2005-01-17, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-05-20, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate cyclase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1625c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30820
      • engineered (56)
      • engineered (123)
      • engineered (125)
    Domains in SCOPe 2.07: d1yk9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yk9A (A:)
    rniiadkydeasvlfadivgfterasstapadlvrfldrlysafdelvdqhglekievsg
    dsymvvsgvprprpdhtqaladfaldmtnvaaqlkdprgnpvplrvglatgpvvagvvgs
    rrfrycvwgdavnvasrmestdsvgqiqvpdevyerlkddfvlrerghinvkgkgvmrtw
    yligrkvaadpgevrgaeprtagv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yk9A (A:)
    dkydeasvlfadivgfterasstapadlvrfldrlysafdelvdqhglekievsgdsymv
    vsgvprprpdhtqaladfaldmtnvaaqlkdprgnpvplrvglatgpvvagvvgsrrfry
    cvwgdavnvasrmestdsvgqiqvpdevyerlkddfvlrerghinvkgkgvmrtwyligr
    kvaa