PDB entry 1yk7

View 1yk7 on RCSB PDB site
Description: Cathepsin K complexed with a cyanopyrrolidine inhibitor
Class: hydrolase
Keywords: cathepsin, catk, cysteine, protease
Deposited on 2005-01-17, released 2005-03-22
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: HOMO SAPIENS
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yk7a1
  • Heterogens: NBL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yk7A (A:)
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm