SCOP: Structural Classification of Proteins and ASTRAL

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

PDB entry 1yk4

View 1yk4 on RCSB PDB site
Description: Ultra-high resolution structure of Pyrococcus abyssi rubredoxin W4L/R5S
Class: electron transport
Keywords: electron transport
Deposited on 2005-01-17, released 2006-01-17
The last revision prior to the SCOP 1.75B freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.69 Å
R-factor: 0.1
AEROSPACI score: 1.51 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: rubredoxin
Species: Pyrococcus abyssi [TaxId:29292]
Gene: rub
Domains in SCOP 1.75B: d1yk4a_
Heterogens: FE, HOH

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>1yk4A (A:)
aklsckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie