PDB entry 1yk1

View 1yk1 on RCSB PDB site
Description: structure of natriuretic peptide receptor-c complexed with brain natriuretic peptide
Deposited on 2005-01-16, released 2006-04-18
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.253
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: atrial natriuretic peptide clearance receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NPR3, ANPRC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: atrial natriuretic peptide clearance receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NPR3, ANPRC
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Natriuretic peptides B
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yk1A (A:)
    psllvltfspcvllgwallaggtggggvggggggagigggrqerealppqkievlvllpq
    ddsylfsltrvrpaieyalrsvegngtgrrllppgtrfqvayedsdcgnralfslvdrva
    aargakpdlilgpvceyaaapvarlashwdlpmlsagalaagfqhkdseyshltrvapay
    akmgemmlalfrhhhwsraalvysddklerncyftlegvhevfqeeglhtsiysfdetkd
    ldledivrniqaservvimcassdtirsimlvahrhgmtsgdyaffnielfnsssygdgs
    wkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssvekqglnmedyvnmfvegf
    hdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagqvsidangdrygdfsviam
    tdveagtqevigdyfgkegrfemrpnvkypwgplklridenrivehtnsspckssggle
    

    Sequence, based on observed residues (ATOM records):
    >1yk1A (A:)
    alppqkievlvllpqddsylfsltrvrpaieyalrsvegllppgtrfqvayedsdcgnra
    lfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaagfqhkdseys
    hltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhevfqeeglhts
    iysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgdyaffnielf
    nsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssvekqglnmed
    yvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagqvsidangdr
    ygdfsviamtdveagtqevigdyfgkegrfemrp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yk1B (B:)
    psllvltfspcvllgwallaggtggggvggggggagigggrqerealppqkievlvllpq
    ddsylfsltrvrpaieyalrsvegngtgrrllppgtrfqvayedsdcgnralfslvdrva
    aargakpdlilgpvceyaaapvarlashwdlpmlsagalaagfqhkdseyshltrvapay
    akmgemmlalfrhhhwsraalvysddklerncyftlegvhevfqeeglhtsiysfdetkd
    ldledivrniqaservvimcassdtirsimlvahrhgmtsgdyaffnielfnsssygdgs
    wkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssvekqglnmedyvnmfvegf
    hdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagqvsidangdrygdfsviam
    tdveagtqevigdyfgkegrfemrpnvkypwgplklridenrivehtnsspckssggle
    

    Sequence, based on observed residues (ATOM records):
    >1yk1B (B:)
    alppqkievlvllpqddsylfsltrvrpaieyalrsvegllppgtrfqvayedsdcgnra
    lfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaagfqhkdseys
    hltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhevfqeeglhts
    iysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgdyaffnielf
    nsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssvekqglnmed
    yvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagqvsidangdr
    ygdfsviamtdveagtqevigdyfgkegrfemrp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1yk1E (E:)
    gcfgrkmdrissssglgckvl